PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00057.126
Common NameAMTR_s00057p00141830
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family ARF
Protein Properties Length: 735aa    MW: 81486.7 Da    PI: 7.1012
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00057.126genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B376.72.5e-24148249199
                                               EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE- CS
                                        B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvlt 62 
                                               f+k+lt sd++++g +++ +++aee+       +  ++ +++l+ +d++g +W++++i+r++++r++lt
  evm_27.model.AmTr_v1.0_scaffold00057.126 148 FCKTLTASDTSTHGGFSVLRRHAEEClprldmsQ--QPPTQDLVAKDLHGVEWRFRHIFRGQPRRHLLT 214
                                               99*****************************633..444569*************************** PP

                                               TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
                                        B3  63 kGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                                               +GW++Fv++++L +gD ++F   + +++el+v+v+r+
  evm_27.model.AmTr_v1.0_scaffold00057.126 215 TGWSGFVSSKRLVAGDAFIFL--RGENGELRVGVRRA 249
                                               *********************..449999*****985 PP

2Auxin_resp118.26.6e-39274356183
                                Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdl 69 
                                               a+ha+st+++F+v+Y+Pr+s+seFv++++++++++k+++s+GmRf+m+fe+e+ +e+r++Gt+vgv+d+
  evm_27.model.AmTr_v1.0_scaffold00057.126 274 AMHAFSTGTMFSVYYRPRTSPSEFVIPYDQYMESVKNNYSIGMRFRMRFEGEETPEQRFTGTIVGVEDY 342
                                               789****************************************************************** PP

                                Auxin_resp  70 dpvrWpnSkWrsLk 83 
                                               d+ rWp SkWr+Lk
  evm_27.model.AmTr_v1.0_scaffold00057.126 343 DSNRWPASKWRCLK 356
                                               ************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.96E-43142277IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.104.5E-41143263IPR015300DNA-binding pseudobarrel domain
CDDcd100177.02E-22147248No hitNo description
SMARTSM010195.6E-22148250IPR003340B3 DNA binding domain
PfamPF023623.6E-22148249IPR003340B3 DNA binding domain
PROSITE profilePS5086312.012148250IPR003340B3 DNA binding domain
PfamPF065072.0E-36274356IPR010525Auxin response factor
SuperFamilySSF542772.5E-13608689No hitNo description
PfamPF023096.0E-12608703IPR033389AUX/IAA domain
PROSITE profilePS5174525.738612705IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009734Biological Processauxin-activated signaling pathway
GO:0010150Biological Processleaf senescence
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0042802Molecular Functionidentical protein binding
Sequence ? help Back to Top
Protein Sequence    Length: 735 aa     Download sequence    Send to blast
MGSCGEGLKG LCPRVNGSSG GDGLSNVSSE PSGGFRDAND GLYTELWHAC AGPLVTVPQM  60
GDKVFYFPQG HTEQVEKSTN QGADQPMPNY DLPSKILCRV VNVWLKAETD TDEVYAQLTL  120
IPEPNQDETT LEKETVQSPP RRPHVYSFCK TLTASDTSTH GGFSVLRRHA EECLPRLDMS  180
QQPPTQDLVA KDLHGVEWRF RHIFRGQPRR HLLTTGWSGF VSSKRLVAGD AFIFLRGENG  240
ELRVGVRRAL RQQNNMPTSV ISSHSMHLGV LATAMHAFST GTMFSVYYRP RTSPSEFVIP  300
YDQYMESVKN NYSIGMRFRM RFEGEETPEQ RFTGTIVGVE DYDSNRWPAS KWRCLKVQWD  360
EQSSVERPLR VSPWKIEPSA APTAINPPPI PRAKRPRTNV PSPSDVSHLS REGLPRGMTE  420
HSQLPRYPGV LQGQEGMALV GGPFSSGTNN PQSHQKSSMW APPLLPPKED PYPHPPHPNW  480
MSLLRSESPF TDKNPPSHWA LSPFPGEKAW PPLGPTLLVG REDQKPLGGG LQSGGCKLFG  540
INLFEHQTEV ASPGIAGFPS RGQQQVVLRT PPPVGLEGDQ VSEQSKGGGK SVDTGSDTDR  600
PLPPKAQSAS TRSCTKVHMQ GNALGRSVDL TKFKGYKDLV AELDRMFGFE GELMDPMKGW  660
QVVYTDDEGD MMLVGDDPWQ EFCVMVRKIY IYTREEVQRM RPRSMSQKGH DVGDHTHETV  720
STPKETASSD ARNC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-172253784354Auxin response factor 1
4ldw_A1e-172253784354Auxin response factor 1
4ldw_B1e-172253784354Auxin response factor 1
4ldx_A1e-172253784354Auxin response factor 1
4ldx_B1e-172253784354Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). {ECO:0000256|RuleBase:RU004561}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00097PBMTransfer from AT1G59750Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFN4331690.0FN433169.1 Amborella trichopoda mRNA for putative auxin response factor 2 (arf2 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006855394.20.0PREDICTED: auxin response factor 2 isoform X2
SwissprotQ6YVY00.0ARFG_ORYSJ; Auxin response factor 7
TrEMBLU5CU840.0U5CU84_AMBTC; Auxin response factor
STRINGPOPTR_0003s16210.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5501582
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62000.30.0auxin response factor 2
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]